SPP1 monoclonal antibody (M14), clone 1A7
  • SPP1 monoclonal antibody (M14), clone 1A7

SPP1 monoclonal antibody (M14), clone 1A7

Ref: AB-H00006696-M14
SPP1 monoclonal antibody (M14), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SPP1.
Información adicional
Size 100 ug
Gene Name SPP1
Gene Alias BNSP|BSPI|ETA-1|MGC110940|OPN
Gene Description secreted phosphoprotein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPP1 (NP_000573.1, 21 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6696
Clone Number 1A7
Iso type IgG2b Kappa

Enviar un mensaje


SPP1 monoclonal antibody (M14), clone 1A7

SPP1 monoclonal antibody (M14), clone 1A7