SPN MaxPab rabbit polyclonal antibody (D01)
  • SPN MaxPab rabbit polyclonal antibody (D01)

SPN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006693-D01
SPN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPN protein.
Información adicional
Size 100 uL
Gene Name SPN
Gene Alias CD43|GPL115|LSN
Gene Description sialophorin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPN (NP_003114.1, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6693

Enviar un mensaje


SPN MaxPab rabbit polyclonal antibody (D01)

SPN MaxPab rabbit polyclonal antibody (D01)