SPI1 monoclonal antibody (M01), clone 1A3
  • SPI1 monoclonal antibody (M01), clone 1A3

SPI1 monoclonal antibody (M01), clone 1A3

Ref: AB-H00006688-M01
SPI1 monoclonal antibody (M01), clone 1A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPI1.
Información adicional
Size 100 ug
Gene Name SPI1
Gene Alias OF|PU.1|SFPI1|SPI-1|SPI-A
Gene Description spleen focus forming virus (SFFV) proviral integration oncogene spi1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPI1 (NP_003111, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6688
Clone Number 1A3
Iso type IgG1 Kappa

Enviar un mensaje


SPI1 monoclonal antibody (M01), clone 1A3

SPI1 monoclonal antibody (M01), clone 1A3