SPI1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SPI1 purified MaxPab rabbit polyclonal antibody (D01P)

SPI1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006688-D01P
SPI1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPI1 protein.
Información adicional
Size 100 ug
Gene Name SPI1
Gene Alias OF|PU.1|SFPI1|SPI-1|SPI-A
Gene Description spleen focus forming virus (SFFV) proviral integration oncogene spi1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPI1 (ENSP00000227163, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6688

Enviar un mensaje


SPI1 purified MaxPab rabbit polyclonal antibody (D01P)

SPI1 purified MaxPab rabbit polyclonal antibody (D01P)