SPARC purified MaxPab rabbit polyclonal antibody (D01P)
  • SPARC purified MaxPab rabbit polyclonal antibody (D01P)

SPARC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006678-D01P
SPARC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPARC protein.
Información adicional
Size 100 ug
Gene Name SPARC
Gene Alias ON
Gene Description secreted protein, acidic, cysteine-rich (osteonectin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPARC (NP_003109.1, 1 a.a. ~ 303 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6678

Enviar un mensaje


SPARC purified MaxPab rabbit polyclonal antibody (D01P)

SPARC purified MaxPab rabbit polyclonal antibody (D01P)