SPAM1 polyclonal antibody (A01)
  • SPAM1 polyclonal antibody (A01)

SPAM1 polyclonal antibody (A01)

Ref: AB-H00006677-A01
SPAM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPAM1.
Información adicional
Size 50 uL
Gene Name SPAM1
Gene Alias HYA1|HYAL1|HYAL3|HYAL5|MGC26532|PH-20|PH20|SPAG15
Gene Description sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPAM1 (NP_003108, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6677

Enviar un mensaje


SPAM1 polyclonal antibody (A01)

SPAM1 polyclonal antibody (A01)