SPAG1 polyclonal antibody (A01)
  • SPAG1 polyclonal antibody (A01)

SPAG1 polyclonal antibody (A01)

Ref: AB-H00006674-A01
SPAG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPAG1.
Información adicional
Size 50 uL
Gene Name SPAG1
Gene Alias FLJ32920|HSD-3.8|SP75|TPIS
Gene Description sperm associated antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPAG1 (NP_003105, 175 a.a. ~ 283 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6674

Enviar un mensaje


SPAG1 polyclonal antibody (A01)

SPAG1 polyclonal antibody (A01)