SP100 polyclonal antibody (A01)
  • SP100 polyclonal antibody (A01)

SP100 polyclonal antibody (A01)

Ref: AB-H00006672-A01
SP100 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SP100.
Información adicional
Size 50 uL
Gene Name SP100
Gene Alias DKFZp686E07254|FLJ00340|FLJ34579
Gene Description SP100 nuclear antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6672

Enviar un mensaje


SP100 polyclonal antibody (A01)

SP100 polyclonal antibody (A01)