SP1 monoclonal antibody (M01A), clone 4H6
  • SP1 monoclonal antibody (M01A), clone 4H6

SP1 monoclonal antibody (M01A), clone 4H6

Ref: AB-H00006667-M01A
SP1 monoclonal antibody (M01A), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP1.
Información adicional
Size 200 uL
Gene Name SP1
Gene Alias -
Gene Description Sp1 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP1 (NP_612482, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6667
Clone Number 4H6
Iso type IgG

Enviar un mensaje


SP1 monoclonal antibody (M01A), clone 4H6

SP1 monoclonal antibody (M01A), clone 4H6