SOX12 monoclonal antibody (M01), clone 2C4
  • SOX12 monoclonal antibody (M01), clone 2C4

SOX12 monoclonal antibody (M01), clone 2C4

Ref: AB-H00006666-M01
SOX12 monoclonal antibody (M01), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX12.
Información adicional
Size 100 ug
Gene Name SOX12
Gene Alias SOX22
Gene Description SRY (sex determining region Y)-box 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6666
Clone Number 2C4
Iso type IgG2b Kappa

Enviar un mensaje


SOX12 monoclonal antibody (M01), clone 2C4

SOX12 monoclonal antibody (M01), clone 2C4