SOX9 polyclonal antibody (A01)
  • SOX9 polyclonal antibody (A01)

SOX9 polyclonal antibody (A01)

Ref: AB-H00006662-A01
SOX9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOX9.
Información adicional
Size 50 uL
Gene Name SOX9
Gene Alias CMD1|CMPD1|SRA1
Gene Description SRY (sex determining region Y)-box 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6662

Enviar un mensaje


SOX9 polyclonal antibody (A01)

SOX9 polyclonal antibody (A01)