SOX5 monoclonal antibody (M01), clone 4H8
  • SOX5 monoclonal antibody (M01), clone 4H8

SOX5 monoclonal antibody (M01), clone 4H8

Ref: AB-H00006660-M01
SOX5 monoclonal antibody (M01), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX5.
Información adicional
Size 100 ug
Gene Name SOX5
Gene Alias L-SOX5|MGC35153
Gene Description SRY (sex determining region Y)-box 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAASQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX5 (NP_008871.3, 181 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6660
Clone Number 4H8
Iso type IgG2b Kappa

Enviar un mensaje


SOX5 monoclonal antibody (M01), clone 4H8

SOX5 monoclonal antibody (M01), clone 4H8