SOX4 polyclonal antibody (A01)
  • SOX4 polyclonal antibody (A01)

SOX4 polyclonal antibody (A01)

Ref: AB-H00006659-A01
SOX4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOX4.
Información adicional
Size 50 uL
Gene Name SOX4
Gene Alias EVI16
Gene Description SRY (sex determining region Y)-box 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6659

Enviar un mensaje


SOX4 polyclonal antibody (A01)

SOX4 polyclonal antibody (A01)