SOX2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SOX2 purified MaxPab rabbit polyclonal antibody (D01P)

SOX2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006657-D01P
SOX2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SOX2 protein.
Información adicional
Size 100 ug
Gene Name SOX2
Gene Alias ANOP3|MCOPS3|MGC2413
Gene Description SRY (sex determining region Y)-box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti
Immunogen Prot. Seq MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian tissue lysate.
Immunogen SOX2 (NP_003097.1, 1 a.a. ~ 317 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6657

Enviar un mensaje


SOX2 purified MaxPab rabbit polyclonal antibody (D01P)

SOX2 purified MaxPab rabbit polyclonal antibody (D01P)