SOX2 polyclonal antibody (A01)
  • SOX2 polyclonal antibody (A01)

SOX2 polyclonal antibody (A01)

Ref: AB-H00006657-A01
SOX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SOX2.
Información adicional
Size 50 uL
Gene Name SOX2
Gene Alias ANOP3|MCOPS3|MGC2413
Gene Description SRY (sex determining region Y)-box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGHRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX2 (AAH13923, 1 a.a. ~ 317 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6657

Enviar un mensaje


SOX2 polyclonal antibody (A01)

SOX2 polyclonal antibody (A01)