SOS2 polyclonal antibody (A01)
  • SOS2 polyclonal antibody (A01)

SOS2 polyclonal antibody (A01)

Ref: AB-H00006655-A01
SOS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOS2.
Información adicional
Size 50 uL
Gene Name SOS2
Gene Alias FLJ25596
Gene Description son of sevenless homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDRECLNQAITALMNHQGSMDRIYKQYSPRRRPGDPVCPFYSHQLRSKHLAIKKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOS2 (NP_008870, 312 a.a. ~ 420 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6655

Enviar un mensaje


SOS2 polyclonal antibody (A01)

SOS2 polyclonal antibody (A01)