SORD monoclonal antibody (M01), clone 4D3
  • SORD monoclonal antibody (M01), clone 4D3

SORD monoclonal antibody (M01), clone 4D3

Ref: AB-H00006652-M01
SORD monoclonal antibody (M01), clone 4D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SORD.
Información adicional
Size 100 ug
Gene Name SORD
Gene Alias SORD1
Gene Description sorbitol dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORD (NP_003095, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6652
Clone Number 4D3
Iso type IgG1 Kappa

Enviar un mensaje


SORD monoclonal antibody (M01), clone 4D3

SORD monoclonal antibody (M01), clone 4D3