SORD purified MaxPab rabbit polyclonal antibody (D01P)
  • SORD purified MaxPab rabbit polyclonal antibody (D01P)

SORD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006652-D01P
SORD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SORD protein.
Información adicional
Size 100 ug
Gene Name SORD
Gene Alias SORD1
Gene Description sorbitol dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SORD (NP_003095.1, 1 a.a. ~ 357 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6652

Enviar un mensaje


SORD purified MaxPab rabbit polyclonal antibody (D01P)

SORD purified MaxPab rabbit polyclonal antibody (D01P)