SORD purified MaxPab mouse polyclonal antibody (B01P)
  • SORD purified MaxPab mouse polyclonal antibody (B01P)

SORD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006652-B01P
SORD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SORD protein.
Información adicional
Size 50 ug
Gene Name SORD
Gene Alias SORD1
Gene Description sorbitol dehydrogenase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IHC-P
Immunogen Prot. Seq MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SORD (NP_003095.1, 1 a.a. ~ 357 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6652

Enviar un mensaje


SORD purified MaxPab mouse polyclonal antibody (B01P)

SORD purified MaxPab mouse polyclonal antibody (B01P)