SOLH monoclonal antibody (M09), clone 2H7
  • SOLH monoclonal antibody (M09), clone 2H7

SOLH monoclonal antibody (M09), clone 2H7

Ref: AB-H00006650-M09
SOLH monoclonal antibody (M09), clone 2H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOLH.
Información adicional
Size 100 ug
Gene Name SOLH
Gene Alias CAPN15|MGC131491
Gene Description small optic lobes homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOLH (NP_005623, 993 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6650
Clone Number 2H7
Iso type IgG2a Kappa

Enviar un mensaje


SOLH monoclonal antibody (M09), clone 2H7

SOLH monoclonal antibody (M09), clone 2H7