SOD3 polyclonal antibody (A01)
  • SOD3 polyclonal antibody (A01)

SOD3 polyclonal antibody (A01)

Ref: AB-H00006649-A01
SOD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOD3.
Información adicional
Size 50 uL
Gene Name SOD3
Gene Alias EC-SOD|MGC20077
Gene Description superoxide dismutase 3, extracellular
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOD3 (AAH14418, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6649

Enviar un mensaje


SOD3 polyclonal antibody (A01)

SOD3 polyclonal antibody (A01)