SNTB2 MaxPab mouse polyclonal antibody (B01)
  • SNTB2 MaxPab mouse polyclonal antibody (B01)

SNTB2 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00006645-B01
SNTB2 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNTB2 protein.
Información adicional
Size 50 uL
Gene Name SNTB2
Gene Alias D16S2531E|EST25263|SNT2B2|SNT3|SNTL
Gene Description syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAAR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNTB2 (ENSP00000353686, 1 a.a. ~ 267 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6645

Enviar un mensaje


SNTB2 MaxPab mouse polyclonal antibody (B01)

SNTB2 MaxPab mouse polyclonal antibody (B01)