SNX1 purified MaxPab rabbit polyclonal antibody (D01P) Ver mas grande

SNX1 purified MaxPab rabbit polyclonal antibody (D01P)

AB-H00006642-D01P

Producto nuevo

SNX1 purified MaxPab rabbit polyclonal antibody (D01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name SNX1
Gene Alias HsT17379|MGC8664|SNX1A|Vps5
Gene Description sorting nexin 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX1 (NP_003090.2, 1 a.a. ~ 522 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6642

Más información

Rabbit polyclonal antibody raised against a full-length human SNX1 protein.

Consulta sobre un producto

SNX1 purified MaxPab rabbit polyclonal antibody (D01P)

SNX1 purified MaxPab rabbit polyclonal antibody (D01P)