SNRPB purified MaxPab rabbit polyclonal antibody (D01P)
  • SNRPB purified MaxPab rabbit polyclonal antibody (D01P)

SNRPB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006628-D01P
SNRPB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNRPB protein.
Información adicional
Size 100 ug
Gene Name SNRPB
Gene Alias COD|SNRPB1|SmB/SmB'|snRNP-B
Gene Description small nuclear ribonucleoprotein polypeptides B and B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNRPB (NP_937859.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6628

Enviar un mensaje


SNRPB purified MaxPab rabbit polyclonal antibody (D01P)

SNRPB purified MaxPab rabbit polyclonal antibody (D01P)