SNCG purified MaxPab mouse polyclonal antibody (B01P)
  • SNCG purified MaxPab mouse polyclonal antibody (B01P)

SNCG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006623-B01P
SNCG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNCG protein.
Información adicional
Size 50 ug
Gene Name SNCG
Gene Alias BCSG1|SR
Gene Description synuclein, gamma (breast cancer-specific protein 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNCG (AAH14098.1, 1 a.a. ~ 127 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6623

Enviar un mensaje


SNCG purified MaxPab mouse polyclonal antibody (B01P)

SNCG purified MaxPab mouse polyclonal antibody (B01P)