SNCA purified MaxPab rabbit polyclonal antibody (D01P)
  • SNCA purified MaxPab rabbit polyclonal antibody (D01P)

SNCA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006622-D01P
SNCA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNCA protein.
Información adicional
Size 100 ug
Gene Name SNCA
Gene Alias MGC110988|NACP|PARK1|PARK4|PD1
Gene Description synuclein, alpha (non A4 component of amyloid precursor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNCA (NP_000336.1, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6622

Enviar un mensaje


SNCA purified MaxPab rabbit polyclonal antibody (D01P)

SNCA purified MaxPab rabbit polyclonal antibody (D01P)