SNCB purified MaxPab mouse polyclonal antibody (B01P)
  • SNCB purified MaxPab mouse polyclonal antibody (B01P)

SNCB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006620-B01P
SNCB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNCB protein.
Información adicional
Size 50 ug
Gene Name SNCB
Gene Alias -
Gene Description synuclein, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNCB (NP_001001502.1, 1 a.a. ~ 134 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6620

Enviar un mensaje


SNCB purified MaxPab mouse polyclonal antibody (B01P)

SNCB purified MaxPab mouse polyclonal antibody (B01P)