SNAI1 monoclonal antibody (M41), clone 1A5
  • SNAI1 monoclonal antibody (M41), clone 1A5

SNAI1 monoclonal antibody (M41), clone 1A5

Ref: AB-H00006615-M41
SNAI1 monoclonal antibody (M41), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNAI1.
Información adicional
Size 100 ug
Gene Name SNAI1
Gene Alias SLUGH2|SNA|SNAH|dJ710H13.1
Gene Description snail homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,S-ELISA,ELISA
Immunogen Prot. Seq LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6615
Clone Number 1A5
Iso type IgG1 Kappa

Enviar un mensaje


SNAI1 monoclonal antibody (M41), clone 1A5

SNAI1 monoclonal antibody (M41), clone 1A5