SMO monoclonal antibody (M10), clone 2F12
  • SMO monoclonal antibody (M10), clone 2F12

SMO monoclonal antibody (M10), clone 2F12

Ref: AB-H00006608-M10
SMO monoclonal antibody (M10), clone 2F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMO.
Información adicional
Size 100 ug
Gene Name SMO
Gene Alias Gx|SMOH
Gene Description smoothened homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMO (NP_005622, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6608
Clone Number 2F12
Iso type IgG1 Kappa

Enviar un mensaje


SMO monoclonal antibody (M10), clone 2F12

SMO monoclonal antibody (M10), clone 2F12