SMO polyclonal antibody (A01)
  • SMO polyclonal antibody (A01)

SMO polyclonal antibody (A01)

Ref: AB-H00006608-A01
SMO polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMO.
Información adicional
Size 50 uL
Gene Name SMO
Gene Alias Gx|SMOH
Gene Description smoothened homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMO (NP_005622, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6608

Enviar un mensaje


SMO polyclonal antibody (A01)

SMO polyclonal antibody (A01)