SMN2 polyclonal antibody (A01)
  • SMN2 polyclonal antibody (A01)

SMN2 polyclonal antibody (A01)

Ref: AB-H00006607-A01
SMN2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMN2.
Información adicional
Size 50 uL
Gene Name SMN2
Gene Alias BCD541|C-BCD541|FLJ76644|MGC20996|MGC5208|SMNC
Gene Description survival of motor neuron 2, centromeric
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMN2 (NP_059107, 191 a.a. ~ 294 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6607

Enviar un mensaje


SMN2 polyclonal antibody (A01)

SMN2 polyclonal antibody (A01)