SMARCE1 monoclonal antibody (M01), clone 6G11
  • SMARCE1 monoclonal antibody (M01), clone 6G11

SMARCE1 monoclonal antibody (M01), clone 6G11

Ref: AB-H00006605-M01
SMARCE1 monoclonal antibody (M01), clone 6G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMARCE1.
Información adicional
Size 100 ug
Gene Name SMARCE1
Gene Alias BAF57
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6605
Clone Number 6G11
Iso type IgG1 Kappa

Enviar un mensaje


SMARCE1 monoclonal antibody (M01), clone 6G11

SMARCE1 monoclonal antibody (M01), clone 6G11