SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)
  • SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)

SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006605-B01P
SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SMARCE1 protein.
Información adicional
Size 50 ug
Gene Name SMARCE1
Gene Alias BAF57
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPSTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMARCE1 (AAH07082.1, 1 a.a. ~ 411 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6605

Enviar un mensaje


SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)

SMARCE1 purified MaxPab mouse polyclonal antibody (B01P)