SMARCE1 polyclonal antibody (A01)
  • SMARCE1 polyclonal antibody (A01)

SMARCE1 polyclonal antibody (A01)

Ref: AB-H00006605-A01
SMARCE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMARCE1.
Información adicional
Size 50 uL
Gene Name SMARCE1
Gene Alias BAF57
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCE1 (NP_003070, 75 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6605

Enviar un mensaje


SMARCE1 polyclonal antibody (A01)

SMARCE1 polyclonal antibody (A01)