SMARCD3 monoclonal antibody (M03A), clone 5G4
  • SMARCD3 monoclonal antibody (M03A), clone 5G4

SMARCD3 monoclonal antibody (M03A), clone 5G4

Ref: AB-H00006604-M03A
SMARCD3 monoclonal antibody (M03A), clone 5G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Información adicional
Size 200 uL
Gene Name SMARCD3
Gene Alias BAF60C|CRACD3|MGC111010|Rsc6p
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6604
Clone Number 5G4
Iso type IgG2a Kappa

Enviar un mensaje


SMARCD3 monoclonal antibody (M03A), clone 5G4

SMARCD3 monoclonal antibody (M03A), clone 5G4