SMARCD2 monoclonal antibody (M01), clone 2F7
  • SMARCD2 monoclonal antibody (M01), clone 2F7

SMARCD2 monoclonal antibody (M01), clone 2F7

Ref: AB-H00006603-M01
SMARCD2 monoclonal antibody (M01), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
Información adicional
Size 100 ug
Gene Name SMARCD2
Gene Alias BAF60B|CRACD2|PRO2451|Rsc6p
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6603
Clone Number 2F7
Iso type IgG2a Kappa

Enviar un mensaje


SMARCD2 monoclonal antibody (M01), clone 2F7

SMARCD2 monoclonal antibody (M01), clone 2F7