SMARCC1 polyclonal antibody (A01)
  • SMARCC1 polyclonal antibody (A01)

SMARCC1 polyclonal antibody (A01)

Ref: AB-H00006599-A01
SMARCC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMARCC1.
Información adicional
Size 50 uL
Gene Name SMARCC1
Gene Alias BAF155|CRACC1|Rsc8|SRG3|SWI3
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ESRKKSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGGKEDEDPAKGDQSRSVDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCC1 (NP_003065, 338 a.a. ~ 437 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6599

Enviar un mensaje


SMARCC1 polyclonal antibody (A01)

SMARCC1 polyclonal antibody (A01)