SMARCB1 monoclonal antibody (M11), clone 3F11
  • SMARCB1 monoclonal antibody (M11), clone 3F11

SMARCB1 monoclonal antibody (M11), clone 3F11

Ref: AB-H00006598-M11
SMARCB1 monoclonal antibody (M11), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Información adicional
Size 100 ug
Gene Name SMARCB1
Gene Alias BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6598
Clone Number 3F11
Iso type IgG2a Kappa

Enviar un mensaje


SMARCB1 monoclonal antibody (M11), clone 3F11

SMARCB1 monoclonal antibody (M11), clone 3F11