SMARCB1 monoclonal antibody (M04), clone 3H3
  • SMARCB1 monoclonal antibody (M04), clone 3H3

SMARCB1 monoclonal antibody (M04), clone 3H3

Ref: AB-H00006598-M04
SMARCB1 monoclonal antibody (M04), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMARCB1.
Información adicional
Size 100 ug
Gene Name SMARCB1
Gene Alias BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6598
Clone Number 3H3
Iso type IgG2b Kappa

Enviar un mensaje


SMARCB1 monoclonal antibody (M04), clone 3H3

SMARCB1 monoclonal antibody (M04), clone 3H3