SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)
  • SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)

SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006598-B01P
SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SMARCB1 protein.
Información adicional
Size 50 ug
Gene Name SMARCB1
Gene Alias BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMARCB1 (NP_003064.2, 1 a.a. ~ 385 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6598

Enviar un mensaje


SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)

SMARCB1 purified MaxPab mouse polyclonal antibody (B01P)