Ver mas grande
SMARCB1 polyclonal antibody (A01)
AB-H00006598-A01
Producto nuevo
SMARCB1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | SMARCB1 |
| Gene Alias | BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS |
| Gene Description | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 6598 |
Más información
Mouse polyclonal antibody raised against a partial recombinant SMARCB1.