SNAI2 MaxPab rabbit polyclonal antibody (D01)
  • SNAI2 MaxPab rabbit polyclonal antibody (D01)

SNAI2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006591-D01
SNAI2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNAI2 protein.
Información adicional
Size 100 uL
Gene Name SNAI2
Gene Alias MGC10182|SLUG|SLUGH1|WS2D
Gene Description snail homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNAI2 (NP_003059.1, 1 a.a. ~ 268 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6591

Enviar un mensaje


SNAI2 MaxPab rabbit polyclonal antibody (D01)

SNAI2 MaxPab rabbit polyclonal antibody (D01)