SNAI2 polyclonal antibody (A01)
  • SNAI2 polyclonal antibody (A01)

SNAI2 polyclonal antibody (A01)

Ref: AB-H00006591-A01
SNAI2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SNAI2.
Información adicional
Size 50 uL
Gene Name SNAI2
Gene Alias MGC10182|SLUG|SLUGH1|WS2D
Gene Description snail homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6591

Enviar un mensaje


SNAI2 polyclonal antibody (A01)

SNAI2 polyclonal antibody (A01)