SLIT3 monoclonal antibody (M07), clone 1D11
  • SLIT3 monoclonal antibody (M07), clone 1D11

SLIT3 monoclonal antibody (M07), clone 1D11

Ref: AB-H00006586-M07
SLIT3 monoclonal antibody (M07), clone 1D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLIT3.
Información adicional
Size 100 ug
Gene Name SLIT3
Gene Alias FLJ10764|MEGF5|SLIL2|SLIT1|Slit-3|slit2
Gene Description slit homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLIT3 (NP_003053, 1371 a.a. ~ 1470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6586
Clone Number 1D11
Iso type IgG1 Kappa

Enviar un mensaje


SLIT3 monoclonal antibody (M07), clone 1D11

SLIT3 monoclonal antibody (M07), clone 1D11