SLC22A4 monoclonal antibody (M01), clone 2D3
  • SLC22A4 monoclonal antibody (M01), clone 2D3

SLC22A4 monoclonal antibody (M01), clone 2D3

Ref: AB-H00006583-M01
SLC22A4 monoclonal antibody (M01), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC22A4.
Información adicional
Size 100 ug
Gene Name SLC22A4
Gene Alias MGC34546|MGC40524|OCTN1
Gene Description solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6583
Clone Number 2D3
Iso type IgG1 Kappa

Enviar un mensaje


SLC22A4 monoclonal antibody (M01), clone 2D3

SLC22A4 monoclonal antibody (M01), clone 2D3