SLC22A3 polyclonal antibody (A01)
  • SLC22A3 polyclonal antibody (A01)

SLC22A3 polyclonal antibody (A01)

Ref: AB-H00006581-A01
SLC22A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC22A3.
Información adicional
Size 50 uL
Gene Name SLC22A3
Gene Alias EMT|EMTH|OCT3
Gene Description solute carrier family 22 (extraneuronal monoamine transporter), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC22A3 (NP_068812, 90 a.a. ~ 155 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6581

Enviar un mensaje


SLC22A3 polyclonal antibody (A01)

SLC22A3 polyclonal antibody (A01)