SLCO2A1 polyclonal antibody (A01)
  • SLCO2A1 polyclonal antibody (A01)

SLCO2A1 polyclonal antibody (A01)

Ref: AB-H00006578-A01
SLCO2A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLCO2A1.
Información adicional
Size 50 uL
Gene Name SLCO2A1
Gene Alias OATP2A1|PGT|SLC21A2
Gene Description solute carrier organic anion transporter family, member 2A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLCO2A1 (NP_005621, 276 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6578

Enviar un mensaje


SLCO2A1 polyclonal antibody (A01)

SLCO2A1 polyclonal antibody (A01)