SLC20A1 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC20A1 purified MaxPab mouse polyclonal antibody (B01P)

SLC20A1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006574-B01P
SLC20A1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC20A1 protein.
Información adicional
Size 50 ug
Gene Name SLC20A1
Gene Alias DKFZp686J2397|FLJ41426|GLVR1|Glvr-1|PIT1|PiT-1
Gene Description solute carrier family 20 (phosphate transporter), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC20A1 (NP_005406.3, 1 a.a. ~ 679 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6574

Enviar un mensaje


SLC20A1 purified MaxPab mouse polyclonal antibody (B01P)

SLC20A1 purified MaxPab mouse polyclonal antibody (B01P)