SLC20A1 polyclonal antibody (A01)
  • SLC20A1 polyclonal antibody (A01)

SLC20A1 polyclonal antibody (A01)

Ref: AB-H00006574-A01
SLC20A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SLC20A1.
Información adicional
Size 50 uL
Gene Name SLC20A1
Gene Alias DKFZp686J2397|FLJ41426|GLVR1|Glvr-1|PIT1|PiT-1
Gene Description solute carrier family 20 (phosphate transporter), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC20A1 (AAH19944, 1 a.a. ~ 679 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6574

Enviar un mensaje


SLC20A1 polyclonal antibody (A01)

SLC20A1 polyclonal antibody (A01)