SLC14A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC14A1 purified MaxPab rabbit polyclonal antibody (D01P)

SLC14A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006563-D01P
SLC14A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC14A1 protein.
Información adicional
Size 100 ug
Gene Name SLC14A1
Gene Alias FLJ33745|FLJ41687|HUT11|HsT1341|JK|RACH1|UT-B1|UT1|UTE
Gene Description solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVVFVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKGDYFWWLLLPVCAMSMTCPIFSSALNSVLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC14A1 (AAH50539.1, 1 a.a. ~ 389 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6563

Enviar un mensaje


SLC14A1 purified MaxPab rabbit polyclonal antibody (D01P)

SLC14A1 purified MaxPab rabbit polyclonal antibody (D01P)